General Information

  • ID:  hor004003
  • Uniprot ID:  Q9NIP6(117-130)
  • Protein name:  Drm-PK-1 2-15
  • Gene name:  Capa
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  In larvae, the precursor peptide is exclusively present in a single pair of neuroendocrine cells in the labial neuromere (subesophageal ganglion) and three pairs of cells in the ventral ganglion abdominal neuromeres.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0008613 diuretic hormone activity; GO:0016084 myostimulatory hormone activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0006812 monoatomic cation transport; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0038060 nitric oxide-cGMP-mediated signaling pathway; GO:0042045 epithelial fluid transport
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPSASSGLWFGPRL
  • Length:  14(117-130)
  • Propeptide:  MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLANSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKELN
  • Signal peptide:  MKSMLVHIVLVIFIIAEFSTA
  • Modification:  T14 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CAP-1 and CAP-2, but not CAP-3 are ligands for the Capa receptor (PubMed:12177421, PubMed:12459185). CAP-1 and CAP-2 are probably components of the signal transduction pathway that leads to Malpighian tubule fluid secretion via the second messenger nitric
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9NIP6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004003_AF2.pdbhor004003_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 166366 Formula: C66H98N18O18
Absent amino acids: CDEHIKMNQTVY Common amino acids: GS
pI: 10.55 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: 0 Boman Index: -534
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 62.86
Instability Index: 4832.86 Extinction Coefficient cystines: 5500
Absorbance 280nm: 423.08

Literature

  • PubMed ID:  16441518
  • Title:  Direct Mass Spectrometric Peptide Profiling and Fragmentation of Larval Peptide Hormone Release Sites in Drosophila Melanogaster Reveals Tagma-Specific Peptide Expression and Differential Processing